PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G10960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 336aa    MW: 35719.6 Da    PI: 7.9894
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G10960.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-175095147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l+d+v+q+G+ +W++Ia+++  gR++k+c++rw++ 
  OMERI01G10960.1 50 RGHWRPAEDAKLKDLVAQYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 95
                     899*****************************.***********996 PP

2Myb_DNA-binding57.63e-18102146147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r ++T+eE+e+l  a++ +G++ W++Iar ++ gRt++ +k++w+ +
  OMERI01G10960.1 102 RRAFTEEEEERLMAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHVL 146
                      678*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1264596IPR017930Myb domain
SMARTSM007174.7E-144998IPR001005SANT/Myb domain
SuperFamilySSF466893.74E-2850143IPR009057Homeodomain-like
PfamPF002497.1E-165095IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-2751103IPR009057Homeodomain-like
CDDcd001671.66E-135394No hitNo description
PROSITE profilePS5129427.2897151IPR017930Myb domain
SMARTSM007174.1E-15101149IPR001005SANT/Myb domain
PfamPF002493.8E-15102146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-21104149IPR009057Homeodomain-like
CDDcd001675.19E-12104147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MAHEMMGGFF GHPPPPPATA AVDEVEEEEV VEETEEGGHG GGVQGKLCAR GHWRPAEDAK  60
LKDLVAQYGP QNWNLIAEKL DGRSGKSCRL RWFNQLDPRI NRRAFTEEEE ERLMAAHRAY  120
GNKWALIARL FPGRTDNAVK NHWHVLMARR HREQSGAFRR RKPSSSSSSA SAAPAPPPPP  180
PPQPVVALHH HHRYAQQYSG YSGAAESDES ASTCTTDLSL SSGSAAAAAA AANIPCFYQS  240
TPRASSSSTA ACRAPRVAAA ADTVAFFPSA GYDFVAAPHA MAPAAASAFA PSARSAFSAP  300
ARRGEPPGAA DQRGGARATT DSHTIPFFDF LGVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-34501507107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0008360.0AP000836.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, clone:P0038F12.
GenBankAP0008370.0AP000837.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, clone:P0424A08.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631112.11e-177PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0E0C0M60.0A0A0E0C0M6_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g16810.11e-176(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.14e-71myb domain protein 105